hvadskalvispisetilaftensmad.dk is a .dk domain served by 2 nameservers (ernest.ns.cloudflare.com, katja.ns.cloudflare.com). It was already in the .dk zone when our tracking began on 16 June 2026. Its website address 104.21.70.141 is hosted by Cloudflare, Inc. (AS13335). Mail is handled by mx.simply.com. The zone is not DNSSEC-signed, has no DMARC policy and is reachable over IPv6. Below are all of its DNS records from our latest scan: nameservers, A/AAAA, MX, TXT, SPF, DMARC, CAA, TLSA/DANE, MTA-STS, SRV and more.
| IP | TTL | PTR | ASN | ISP / Org | CIDR | Country | City |
|---|---|---|---|---|---|---|---|
| 104.21.70.141 | 300s | — | AS13335 | Cloudflare, Inc. | 104.21.0.0/17 | — | — |
| 172.67.136.50 | 300s | — | AS13335 | Cloudflare, Inc. | 172.67.128.0/17 | — | — |
| Priority | TTL | Mail Server | IP addresses | PTR | ASN |
|---|---|---|---|---|---|
| 10 | 300s | mx.simply.com | 94.231.106.20 | mx.simply.com | AS48854 team.blue Denmark A/S |
| Service | CNAME / IP |
|---|---|
| 🔷 Autodiscover | 104.21.70.141 |
| 🔶 Autoconfig | 172.67.136.50 |
| IPv6 Address | TTL | PTR | ASN | ISP / Org | CIDR | Country | City |
|---|---|---|---|---|---|---|---|
| 2606:4700:3031::ac43:8832 | 300s | — | AS13335 | Cloudflare, Inc. | 2606:4700:3000:0:0:0:0:0/42 | — | — |
| 2606:4700:3036::6815:468d | 300s | — | AS13335 | Cloudflare, Inc. | 2606:4700:3000:0:0:0:0:0/42 | — | — |
| Priority | Target | SvcParams |
|---|---|---|
| 1 service | . | alpn="h3,h2" ipv4hint=104.21.70.141,172.67.136.50 ech=AEX+DQBBXQAgACAMpYldYzQ9l7qOXBLrrdhR4BcdHHeNfu4qhqehUSG4NQAEAAEAAQASY2xvdWRmbGFyZS1lY2guY29tAAA= ipv6hint=2606:4700:3031::ac43:8832,2606:4700:3036::6815:468d |
| www | 104.21.70.141 172.67.136.50 2606:4700:3031::ac43:8832 2606:4700:3036::6815:468d (AS13335) (address records, no CNAME) |
| www vs bare domain | Same network hvadskalvispisetilaftensmad.dk: 104.21.70.141 172.67.136.50 2606:4700:3031::ac43:8832 2606:4700:3036::6815:468d (AS13335) www.hvadskalvispisetilaftensmad.dk: 104.21.70.141 172.67.136.50 2606:4700:3031::ac43:8832 2606:4700:3036::6815:468d (AS13335) |
| Wildcard | Yes: any name under the zone resolves |
| Service / Owner | Type | Cert association |
|---|---|---|
| SMTP _25._tcp.mx.simply.com | DANE-EE · SPKI · SHA-256 | 4B949F05A63FED95FC94B3A83DD70167… |
| SMTP _25._tcp.mx.simply.com | DANE-EE · SPKI · SHA-256 | 97A3BA009F39C761BFFB6574340E8138… |
| SMTP _25._tcp.mx.simply.com | DANE-EE · SPKI · SHA-256 | A9D603AF4D7ED6B9246B4B68500CD6F2… |
| Check | Result |
|---|---|
| Validation Status | 🔓 Insecure |
| AD Flag (resolver validates) | ✗ Not set |
| DS Record | ✗ Not found |
| DNSKEY Record | ✗ Not found |
| Flags | unsigned answer |
| Field | Value |
|---|---|
| Serial | 2415662509 |
| Primary NS (MNAME) | ernest.ns.cloudflare.com |
| Responsible (RNAME) | dns@cloudflare.com |
| Refresh | 10000s |
| Retry | 2400s |
| Expire | 604800s |
| Minimum (neg-cache TTL) | 1800s |
| Scanned At | Duration | Records | DNSSEC |
|---|---|---|---|
| 2026-09-30 13:01:54 shown | 930ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-09-26 04:58:24 | 643ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-09-24 15:24:40 | 694ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-09-11 18:39:07 | 792ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-09-06 02:56:17 | 648ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-08-31 12:48:09 | 755ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-08-27 14:46:10 | 1455ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-07-26 19:50:21 | 1699ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-06-20 19:36:46 | 526ms | 2 NS 2 A 1 MX | 🔓 Insecure |
| 2026-06-20 14:59:21 | 963ms | 0 NS 0 A 0 MX | ❓ Unknown |
| 2026-06-17 11:33:51 | 1789ms | 2 NS 2 A 1 MX | 🔓 Insecure |